Par Lson Lee · Développeur indépendant & passionné de jeux de mots

Base de mots

5-Letter Words With Only One Vowel (A, E, I, O, or U)

743 mots trouvés

Liste de référence pour les fans de jeux de mots. Exemples : abysm, abyss, aggry, alkyd, alkyl, allyl, ambry, amply

abysmabyssaggryalkydalkylallylambryamplyangryangstapplyaptlyartsybadlybaggybalmybatchbattybawdybelchbellybenchberryberthbiddybillybirchbirthbittyblackblandblankblastblendblessblimpblindblinkblissblitzblockblondblownbluffbluntblurbblurtblushbobbybossybotchbrandbrashbrassbrawlbrawnbrickbringbrinkbrinybriskbrothbrownbruntbrushbuddybuggybulkybullybunchbunnyburlyburntburstbushybutchbylawcabbycaddycandycannycarrycatchcattychaffchalkchampchantchardcharmchartchasmcheckchesschestchickchildchillchirpchockchordchuckchumpchunkchurncinchclackclampclangclankclashclaspclasscleftclerkclickcliffclimbclingclinkclockclothclowncluckclumpclungcomfyconchcornycoylycrackcraftcrampcrankcrashcrasscrawlcrazycreptcresscrestcrickcrimpcrispcrockcronycrosscrowdcrowncrumbcrumpcrushcrustcurlycurrycurvycybercyclecynicdaddydallydandydecrydepthderbydillydimlydingydirtyditchdittydizzydodgydollydowdydownydowrydraftdrankdrawldrawndressdriftdrilldrinkdrolldrossdrowndrunkdryerduchydullydummydumpyduskydustydutchdwarfdwelldweltdyingemptyentryfancyfannyfattyferryfetchfifthfiftyfightfillyfilmyfilthfinchfirstfishyfizzyfjordflackflakyflankflashflaskfleckfleshflickflingflintflirtflockflossflownfluffflungflunkflushflyerfoggyfollyforthfortyfrankfreshfrillfriskfritzfrockfrondfrontfrostfrothfrownfullyfunkyfunnyfurryfussyfuzzygassygawkygaylyghostgiddygipsygirlygirthglandglassglintgloryglossgnashgodlygollygraftgrandgrantgraphgraspgrassgravygrillgrimygrindgrossgrowlgrowngruffgruntgulchgullygummyguppygustyhandyhappyhardyharpyharryharshhastyhatchheftyherbshillyhippyhitchhobbyhollyhornyhotlyhowdyhumphhunchhunkyhurryhuskyhussyhutchhydrohymenhyperidyllimplyitchyjazzyjellyjerkyjettyjiffyjollyjumpykinkykittyknackkneltknockknollknownkrilllankylatchleftyleggylightlobbyloftylorrylowlyluckylumpylunchlurchlustylyinglyricmadlymammymangymanlymarchmarrymarshmatchmercymerrymidstmightmilkymintymirthmissymoldymonthmorphmossymuckymuddymulchmummymunchmurkymushymuskymustynannynastynerdynewlynightninnyninthnoblynorthnotchnuttynylonoddlypaddypalsypansyparrypartypastypatchpatsypattypennyperchperkypeskypettyphonypickypiggypinchpinkypitchpithyplankplantpluckplumbplumpplunkplushpolyppoppyporchprankprawnpressprickprintprismprivyprongprowlproxypsalmpudgypuffypulpypunchpuppypushyputtyrallyralphranchrandyraspyrattyreplyretchretryrhymerightriskyrockyrowdyruddyrugbyrustysadlysallysaltysandysappysassysatyrsavvyscaldscalpscalyscampscantscarfscaryscentscoffscoldscornscowlscramscrapscrewscrubscrumshackshadyshaftshakyshallshaltshankshardsharksharpshawlshelfshellshiftshinyshirkshirtshockshornshortshownshowyshrewshrubshrugshuckshuntshushsightsilkysillysissysixthsixtyskiffskillskimpskirtskulkskullskunkslackslangslantslashsleptslickslimyslingslinksloshslothslumpslungslunkslurpslushsmacksmallsmartsmashsmellsmeltsmirksmithsmocksmokysnacksnakysnarlsniffsnortsnowysnucksnuffsoggysorryspanksparkspasmspawnspeckspellspeltspendspentspermspicyspikyspillspiltspinysplatsplitsportspraysprigspunkspurnspurtstackstaffstalkstallstampstandstankstarkstartstashstaysstemsstepssternstickstiffstillstiltstingstinkstintstockstompstonystorkstormstorystrapstrawstraystripstrutstuckstudystuffstumpstungstunkstuntstylesulkysullysunnysurlyswampswarmswashswathswellsweptswiftswillswingswirlswishswordswornswungsynodsyruptabbytackytaffytallytangytardytastytattytawnyteddytenthtermstestythanktheftthickthighthingthinkthirdthongthornthrewthrobthrowthrumthumbthumpthymetighttipsytoddytorchtracktracttramptrashtrawltrendtricktrolltrucktrulytrumptrunktrusstrusttruthtwangtwirltwisttwixttyingvinylvyingwackywaltzwartywatchwelchwelshwhackwharfwhelpwhichwhiffwhinywhirlwhiskwidthwightwillywimpywinchwindywispywitchwittywordyworldworryworstworthwrackwrathwreckwrestwringwristwrongwrungyachtzesty

Conseils pour les jeux de mots

Appliquer les contraintes dans l’ordre

Verrouillez d’abord les verts, puis les positions jaunes, puis éliminez les gris. Refiltrez mentalement cette liste au fil des découvertes.

Équilibrer voyelles et consonnes

Les premiers essais mélangent souvent des voyelles fréquentes et des consonnes comme R, S, T, L, N pour maximiser l’information par tour.

Attention aux doublons

Certaines solutions répètent une lettre. Si vous bloquez, parcourez le motif « lettres doubles » ou testez des paires à partir des lettres sûres.

FAQ

What is special about “5-Letter Words With Only One Vowel (A, E, I, O, or U)”?

This pattern matches 743 words in our database. Examples: abysm, abyss, aggry, alkyd, alkyl, allyl, ambry, amply.

How are these patterns useful?

Structural filters — doubles, palindromes, unique letters — match how experienced players reason about constraints after the first few guesses.

Does Word Words use the same word list as Wordle?

Official apps use their own dictionaries. This independent fan site provides general vocabulary reference only.

Sujets connexes

Essayer Word Words gratuitement sur iPhone

Puzzles infinis. Difficulté adaptative. Aucune pub forcée.

Télécharger sur l'App Store